Tesamorelin
GHRH Analog · Visceral Fat Reduction
Tesamorelin is an FDA-approved synthetic GHRH analog designed for HIV-associated lipodystrophy treatment. It provides selective visceral fat targeting with 15-20% visceral fat reduction in clinical trials while preserving subcutaneous fat.
Overview
Tesamorelin is an FDA-approved synthetic GHRH analog designed for HIV-associated lipodystrophy treatment. It provides selective visceral fat targeting with 15-20% visceral fat reduction in clinical trials while preserving subcutaneous fat.
Subcutaneous injection provides optimal bioavailability for GHRH receptor binding and pulsatile GH release stimulation, selectively targeting visceral adipose tissue while sparing subcutaneous fat.
Research indications
What the compound has been studied for, grouped by body system. Effect size is the reported magnitude where it was measured — not a recommendation.
FDA-approved indication showing 15-20% visceral fat reduction in clinical trials.
Unique mechanism that reduces dangerous visceral fat while sparing subcutaneous fat.
Maintained weight loss with continuous treatment over 52+ weeks in clinical studies.
12.3% reduction in triglyceride levels.
7.2% improvement in cholesterol markers.
37% liver fat reduction over 12 months.
Preserves lean muscle mass during fat loss.
26% increase in IGF-1 levels.
A large effect in a weak study and a small effect in a strong one are different things. Effect size is never evidence of use in people.
- Class
- GHRH analog
- Chain length
- 44 residues
- Molecular weight
- 5135.9 Da
- Half-life
- ~32 min
- Typical dose
- 1.4-2mg daily (FDA-approved: 2mg for HIV lipodystrophy)
- Frequency
- Once daily (evening preferred for GH rhythm)
- Cycle length
- Continuous therapy for maintained benefits
- Storage
- Powder: 20-25°C. Egrifta SV: use immediately. Egrifta WR: room temp up to 7 days
Molecular data
- Type
- GHRH analog
- Molecular weight
- 5135.9 Da
- Chain length
- 44 residues
- Half-life
- 32 min
HADGIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLDosing reference
Doses reported in the literature and by suppliers. These are a record of what has been used in research — reference, never instruction.
| Context | Route | Amount | Frequency |
|---|---|---|---|
| HIV Lipodystrophy (FDA-approved) | SubQ | 1.4mg | Once daily |
| Visceral Fat Reduction | SubQ | 2mg | Once daily |
| Anti-aging/Body Composition | SubQ | 1-2mg | 5-7x weekly |
| NAFLD Treatment | SubQ | 2mg | Once daily (12 months) |
| Cognitive Enhancement | SubQ | 1mg | Once daily (20 weeks) |
Interactions
Synergistic GH stimulation; monitor IGF-1 levels.
Combined use may elevate IGF-1 supraphysiologically.
Similar mechanism; risk of excessive effects at higher doses.
3.3-fold diabetes risk increase; monitor glucose closely.
May mitigate glucose intolerance associated with tesamorelin.
Decreases corticosteroid effectiveness.
Blocks GH release, negates tesamorelin effects.
Redundant; risk of acromegaly-like effects.
Quality checklist
- ✓FDA-approved formulations (Egrifta SV/WR from licensed pharmacy)
- ✓White crystalline powder (uniform, cake-like)
- ✓Clear reconstituted solution (colorless, no particles)
- ✓Proper packaging (sealed vials, intact stoppers)
- !Compounded formulations may have quality/potency variability
- ×Discolored or cloudy solution (yellow/brown indicates degradation)
- ×Visible particles or precipitate
What to expect
Safety
- Injection site reactions (17%)
- Joint pain (13%)
- Water retention
- Development of diabetes or severe glucose intolerance (HbA1c ≥6.5%)
- Signs of malignancy
- Severe hypersensitivity reactions
- Excessive IGF-1 elevation (>2 SD above normal) with acromegaly symptoms
- Active malignancy
- Pituitary disorders
- Pregnancy
FAQ
Does tesamorelin specifically target visceral fat or does it reduce overall body fat?
Tesamorelin uniquely targets visceral (deep abdominal) fat while sparing subcutaneous fat. This selective mechanism makes it FDA-approved specifically for HIV-associated lipodystrophy - the visceral fat reduction of 15-20% occurs without proportional subcutaneous fat loss, improving metabolic health and reducing cardiovascular risk.
Can tesamorelin improve cognitive function or is that just a side benefit?
Cognitive improvement isn't a primary effect, but a Phase 2 trial in 152 older adults (55-87 years) showed favorable effects on cognition, particularly executive function (P=0.005), with 117% IGF-1 increases. This suggests potential anti-aging brain benefits, though larger trials are needed for confirmation.
Does tesamorelin increase diabetes risk like other GH therapies?
Yes, tesamorelin carries a documented 3.3-fold increased diabetes risk compared to placebo. Close glucose monitoring is essential, especially in pre-diabetic patients. Metformin co-treatment may mitigate this risk, and diabetics require careful medication adjustment.
Why use tesamorelin over semaglutide for visceral fat loss?
Tesamorelin uniquely spares subcutaneous fat while targeting visceral fat, making it better for patients wanting to preserve healthy fat deposits. Semaglutide causes general weight loss across all fat depots. Choose tesamorelin for selective visceral fat reduction in metabolically healthy individuals; semaglutide for comprehensive weight loss.
References
- 1Metabolic effects of a growth hormone-releasing factor in patients with HIVFalutz J, Allas S, Blot K, et al. · New England Journal of Medicine · 2007
Landmark RCT in 412 HIV patients: tesamorelin 2 mg daily for 26 weeks reduced visceral fat by 10.9% vs 0.6% placebo, improved lipid profiles with no change in subcutaneous fat.
human-rctPubMed 18057338 ↗ - 2Effects of Tesamorelin in HIV-Infected Patients with Abdominal Fat Accumulation: Randomized Placebo-Controlled Trial with Safety Extension (CTR-1011)Falutz, J., et al. · Journal of Acquired Immune Deficiency Syndromes · 2010
404 HIV patients treated for up to 12 months. 69% achieved ≥8% VAT reduction vs 33% placebo. VAT benefits were lost upon discontinuation, confirming need for continuous therapy.
human-rctPubMed 20101189 ↗ - 3Effects of Growth Hormone-Releasing Hormone on Cognitive Function in Adults with MCI and Healthy Older AdultsBaker, L.D., et al. · Archives of Neurology · 2012
152 adults (ages 55-87) treated with tesamorelin 1mg daily for 20 weeks. Favorable effect on cognition (P=0.03), with particular benefit on executive function (P=0.005) and IGF-1 increase of 117%.
reviewPubMed 22869065 ↗ - 4Effects of Tesamorelin on Non-Alcoholic Fatty Liver Disease in HIV: A Randomised, Double-Blind, Multicentre TrialStanley, T.L., et al. · Lancet HIV · 2019
61 HIV patients with NAFLD randomized to tesamorelin 2mg vs placebo for 12 months. 37% relative reduction in hepatic fat fraction (P=0.02), with prevention of fibrosis progression on liver biopsy.
human-rctPubMed 31611038 ↗ - 5Body Composition, Hepatic Fat, Metabolic, and Safety Outcomes of Tesamorelin: A Meta-Analysis of Randomized Controlled TrialsElgenidy, A., et al. · HIV Medicine · 2025
Meta-analysis of 5 RCTs showing significant VAT reduction (MD=-27.71 cm², P<0.001), increased lean body mass (MD=1.42 kg, P<0.001), and improved hepatic fat and IGF-1 levels without serious safety concerns.
meta-analysisPubMed 41545261 ↗